missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ TACSTD2 (Human) Recombinant Protein
Human TACSTD2 full-length ORF ( AAH09409, 27 a.a. - 323 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00004070-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
Specifications
| AAH09409 | |
| tumor-associated calcium signal transducer 2 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| TACSTD2 | |
| GST |
| 4070 | |
| Wheat germ expression system | |
| 25 μg | |
| EGP-1, GA733, GA733-1, M1S1, TROP2 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |