Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.
1
–
15
of
3,975
results
R&D Systems™ Human CD163 DuoSet ELISA
Human CD163 DuoSet ELISA from the most referenced ELISA manufacturer. Highly validated for accurate quantitation and long-term reproducibility.
| Content And Storage | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunofluorescence |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Extracellular Matrix |
| Antigen | Claudin-2 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Dilution | Western Blot 1:100 - 1:500, Immunocytochemistry/ Immunofluorescence 1:50-1:100 |
| Gene Alias | claudin 2, claudin-2, SP82 |
| Gene ID (Entrez) | 9075 |
| Formulation | PBS with 50% glycerol, pH7.3. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 30-230 of human CLDN2 (NP_001164566.1). WKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV |
| Classification | Polyclonal |
| Primary or Secondary | Primary |
Respiratory Syncytial Virus Glycoprotein F Antibody (11-6-F9), DyLight 594, Novus Biologicals™
Mouse Monoclonal Antibody
BCMA/TNFRSF17 Antibody (CD269/8508R), Alexa Fluor™ 594, Novus Biologicals™
Rabbit Monoclonal Antibody
| Content And Storage | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | GPCR, Protein Phosphatase, Signal Transduction |
| Concentration | 0.3 mg/mL |
| Antigen | SIRP alpha/CD172a |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Gene Alias | Bit, BITbrain-immunoglobulin-like molecule with tyrosine-based activation motifs, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, CD172a, CD172a antigen, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MFRtyrosine phosphatase SHP substrate 1, MYD1, MYD-1, MyD-1 antigen, P84, protein tyrosine phosphatase, non-receptor type substrate 1, PTPNS1, SHP substrate 1, SHPS-1, SHPS1CD172A, signal-regulatory protein alpha, Signal-regulatory protein alpha-1, Signal-regulatory protein alpha-2, Signal-regulatory protein alpha-3, SIRPalpha, SIRP-ALPHA-1, Sirp-alpha-2, SIRPalpha2, Sirp-alpha-3, SIRPtyrosine-protein phosphatase non-receptor type substrate 1 |
| Gene ID (Entrez) | 140885 |
| Formulation | 50mM Tris-Glycine(pH 7.4), 0.15M NaCl, 40% Glycerol, 0.05% BSA |
| Immunogen | Recombinant protein of human SIRP alpha/CD172a (Uniprot # P78324) |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | S04-7G6 |
| Content And Storage | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human,Mouse,Rat |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,Immunofluorescence |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Cellular Markers, Phospho Specific |
| Concentration | 0.3 mg/mL |
| Antigen | Calretinin |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Gene Alias | 29 kDa calbindin, CAB29, CAL2, calbindin 2, calbindin 2, (29kD, calretinin), calbindin 2, 29kDa (calretinin), calbindin D29K, calretinin, CR |
| Gene ID (Entrez) | 794 |
| Formulation | 50mM Tris-Glycine(pH 7.4), 0.15M NaCl, 40% Glycerol, 0.05% BSA |
| Immunogen | A synthetic peptide of human Calretinin (Uniprot # P22676) |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | S01-2G7 |
| Content And Storage | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
|---|---|
| Target Species | Human |
| Host Species | Rabbit |
| Conjugate | Unconjugated |
| Applications | Western Blot,ELISA,Immunohistochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
| Form | Purified |
| Isotype | IgG |
| Research Discipline | Apoptosis |
| Concentration | 0.3 mg/mL |
| Antigen | cIAP-1/HIAP-2 |
| Regulatory Status | RUO |
| Purification Method | Affinity purified |
| Gene Alias | API1Hiap-2, apoptosis inhibitor 1, baculoviral IAP repeat containing 2, baculoviral IAP repeat-containing 2, baculoviral IAP repeat-containing protein 2, cIAP1, C-IAP1, hIAP2, hIAP-2, IAP homolog B, IAP2, IAP-2, Inhibitor of apoptosis protein 2, MIHBHIAP2, NFR2-TRAF signalling complex protein, RING finger protein 48, RNF48hiap-2, TNFR2-TRAF-signaling complex protein 2 |
| Gene ID (Entrez) | 329 |
| Formulation | 50mM Tris-Glycine(pH 7.4), 0.15M NaCl, 40% Glycerol, 0.05% BSA |
| Immunogen | A synthetic peptide of human cIAP-1/HIAP-2 (Uniprot # Q13490) |
| Classification | Monoclonal |
| Primary or Secondary | Primary |
| Clone | S01-1C5 |