missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ACE-2 Antibody (CL4013), Novus Biologicals™
Mouse Monoclonal Antibody
369.00€ - 529.00€
Specifications
| Antigen | ACE-2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:10000 - 1:20000, Immunohistochemistry-Paraffin 1:10000 - 1:20000 |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18280394
|
Novus Biologicals
NBP2-59036 |
100 μL |
529.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18608156
|
Novus Biologicals
NBP2-59036-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ACE-2 Monoclonal specifically detects ACE-2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ACE-2 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human | |
| 59272 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSSSSWLLLSLVAVTAAQSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQNGSSVLSED | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:10000 - 1:20000, Immunohistochemistry-Paraffin 1:10000 - 1:20000 | |
| Unconjugated | |
| Mouse | |
| Immunology, Virology Bacteria and Parasites | |
| ACEHangiotensin I converting enzyme 2, ACE-related carboxypeptidase, angiotensin I converting enzyme (peptidyl-dipeptidase A) 2, angiotensin-converting enzyme 2, Angiotensin-converting enzyme homolog, DKFZp434A014, EC 3.4.17, EC 3.4.17.23, Metalloprotease MPROT15 | |
| ACE2 | |
| IgG1 | |
| Protein A purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title