missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Alpha Fodrin Rabbit anti-Human, Mouse, Rat, Clone: 9H5V8, Novus Biologicals™
Rabbit Monoclonal Antibody
190.00€ - 497.00€
Specifications
| Antigen | Alpha Fodrin |
|---|---|
| Clone | 9H5V8 |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18335774
|
Novus Biologicals
NBP3-16131-20UL |
20 μg |
190.00€
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18340634
|
Novus Biologicals
NBP3-16131-100UL |
100 μg |
497.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Alpha Fodrin Monoclonal antibody specifically detects Alpha Fodrin in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| Alpha Fodrin | |
| Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| Alpha-II spectrin, EIEE5, FLJ17738, FLJ44613, Fodrin alpha chain, NEAS, spectrin alpha chain, brain, spectrin, alpha, non-erythrocytic 1 (alpha-fodrin), Spectrin, non-erythroid alpha chain, SPTA2 | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Alpha Fodrin (Q13813). MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIV | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| 9H5V8 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Neuroscience | |
| PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
| 6709 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title