missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AMICA/JAML Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 2 publications
362.00€ - 572.00€
Specifications
| Antigen | AMICA/JAML |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18430592
|
Novus Biologicals
NBP2-14286-25ul |
25ul |
362.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18777063
|
Novus Biologicals
NBP2-14286 |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Description
AMICA/JAML Polyclonal specifically detects AMICA/JAML in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| AMICA/JAML | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 120425 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: KKTCGNKSSVNSTVLVKNTKKTNPEIKEKPCHFERCEGEKHIYSPIIVREVIEEEEPSEKSEATYMTMHPVWPSLRSDRNNSL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse | |
| adhesion molecule, interacts with CXADR antigen 1, AMICA, Gm638 | |
| AMICA1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human AMICA/JAML antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title