missing translation for 'onlineSavingsMsg'
Learn More

mitofusin 1, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant MFN1.

Brand: Abnova H00055669-A01.50uL

Product Code. 16118296

242.00€ / 50µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

The protein encoded by this gene is a mediator of mitochondrial fusion. This protein and mitofusin 2 are homologs of the Drosophila protein fuzzy onion (Fzo). They are mitochondrial membrane proteins that interact with each other to facilitate mitochondrial targeting. [provided by RefSeq

Sequence: MAEPVSPLKHFVLAKKAITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDKLSIIGEVLSRRHMKVAFFGRTSSGKSSVINAMLWDKV

Specifications

Antigen	mitofusin 1
Classification	Polyclonal
Description	Mouse polyclonal antibody raised against a partial recombinant MFN1.
Gene	MFN1
Gene Alias	DKFZp762F247/FLJ20693/MGC41806/hfzo1/hfzo2
Host Species	Mouse
Quantity	50 μL
Whole Molecule	Yes
Gene ID (Entrez)	55669
Content And Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Applications	ELISA, Western Blot
Conjugate	Unconjugated
Formulation	50% glycerol
Gene Accession No.	NM_017927
Gene Symbols	MFN1
Immunogen	MFN1 (NP_060397, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Serum

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Spot an opportunity for improvement?Share a Content Correction

mitofusin 1, Mouse, Polyclonal Antibody, Abnova™

Description

Specifications

Product Suggestions

Documents

Promotions