missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 16111382

Thy-1 cell surface antigen, Mouse, Clone: 3F9, Abnova™

Product Code. 16111382
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µg
Product Code. Quantity unitSize
16111382 100 μg 100µg
1 options
This item is not returnable. View return policy

Product Code. 16111382

Brand: Abnova H00007070M01.100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse monoclonal antibody raised against a full-length recombinant THY1.

Sequence: MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL

Specifications

Antigen Thy-1 cell surface antigen
Applications ELISA, Western Blot
Classification Monoclonal
Clone 3F9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant THY1.
Formulation PBS with no preservative; pH 7.4
Gene THY1
Gene Accession No. BC005175
Gene Alias CD90/FLJ33325
Gene Symbols THY1
Host Species Mouse
Immunogen THY1 (AAH05175, 1 a.a. ∼ 161 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Stem Cell Biology
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 7070
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.