missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Apolipoprotein L5 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10809-100UL
This item is not returnable.
View return policy
Description
Apolipoprotein L5 Polyclonal specifically detects Apolipoprotein L5 in Human samples. It is validated for Western Blot.
Specifications
| Apolipoprotein L5 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| apolipoprotein L, 5, apolipoprotein L5, Apolipoprotein L-V, APOLV, APOL-V | |
| The immunogen is a synthetic peptide directed towards the middle region of human Apolipoprotein L5 (NP_085145.1). Peptide sequence DKDSMPDGNLSEEEKLFLSYFPLHKFELEQNIKELNTLADQVDTTHELLT | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 80831 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu