missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARFGAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-14305
This item is not returnable.
View return policy
Description
ARFGAP1 Polyclonal antibody specifically detects ARFGAP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| ARFGAP1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ADP-ribosylation factor 1 GTPase activating protein, ADP-ribosylation factor 1 GTPase-activating protein, ADP-ribosylation factor GTPase activating protein 1, ADP-ribosylation factor GTPase-activating protein 1, ARF GAP 1, ARF1 GAP, ARF1-directed GTPase-activating protein, ARF1GAP, bA261N11.3, FLJ10767, GAP protein, HRIHFB2281, MGC39924 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: DHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWD | |
| 0.1 mL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 55738 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur