missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARFGAP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-14305-25ul
This item is not returnable.
View return policy
Description
ARFGAP1 Polyclonal antibody specifically detects ARFGAP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| ARFGAP1 | |
| Polyclonal | |
| Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/ Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| ADP-ribosylation factor 1 GTPase activating protein, ADP-ribosylation factor 1 GTPase-activating protein, ADP-ribosylation factor GTPase activating protein 1, ADP-ribosylation factor GTPase-activating protein 1, ARF GAP 1, ARF1 GAP, ARF1-directed GTPase-activating protein, ARF1GAP, bA261N11.3, FLJ10767, GAP protein, HRIHFB2281, MGC39924 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: DHFQNSNIDQSFWETFGSAEPTKTRKSPSSDSWTCADTSTERRSSDSWEVWGSASTNRNSNSDGGEGGEGTKKAVPPAVPTDDGWD | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| 55738 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction