missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ARSI Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 572.00€
Specifications
| Antigen | ARSI |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18674347
|
Novus Biologicals
NBP2-48681-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18618788
|
Novus Biologicals
NBP2-48681 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ARSI Polyclonal antibody specifically detects ARSI in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ARSI | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| arylsulfatase family, member I, arylsulfatase I, ASI, EC 3.1.6, EC 3.1.6.-, EC 3.1.6.12, FLJ16069 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SADPYEREDLAGQRPDVVRTLLARLAEYNRTAIPVRYPAENPRAHPDFNGGAWGPWASDEEEE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.2), 40% Glycerol | |
| 340075 | |
| IgG | |
| Immunogen affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title