missing translation for 'onlineSavingsMsg'
Learn More
Learn More
5-HT7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68957-25ul
This item is not returnable.
View return policy
Description
5-HT7 Polyclonal antibody specifically detects 5-HT7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| 5-HT7 | |
| Polyclonal | |
| Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
| 5-HT-7, 5-HT75-hydroxytryptamine receptor 7, 5-HT-X, 5-hydroxytryptamine (serotonin) receptor 7 (adenylate cyclase-coupled), serotonin 5-HT-7 receptor, Serotonin receptor 7 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NRDLRTTYRSLLQCQYRNINRKLSAAGMHEALKLAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHN | |
| 25 μL | |
| GPCR, Neuronal Cell Markers, Neuroscience, Neurotransmission | |
| 3363 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction