missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B3GNTL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-90839-25ul
This item is not returnable.
View return policy
Description
B3GNTL1 Polyclonal specifically detects B3GNTL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| B3GNTL1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| B3GNT8, beta-1,3-Gn-T8, beta-1,3-N-acetylglucosaminyltransferase 8, beta1,3-N-acetylglucosaminyltransferase-like protein 1, beta3Gn-T8, beta3GnTL1, beta3Gn-T-like protein 1, BGnT-8, BGnT-like protein 1, MGC126253, MGC126256, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like 1, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase-like protein 1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 146712 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| B3GNTL1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SSGSYLCFLDSDDVMMPQRVRLQHEAAVQHPSSIIGCRVRRDPPNSTERYTRWINQLTPEQLLTQVFTSNGPTV | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering