missing translation for 'onlineSavingsMsg'
Learn More
Learn More
bcl10-interacting CARD protein Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 539.00€
Specifications
| Antigen | bcl10-interacting CARD protein |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18147518
|
Novus Biologicals
NBP2-38402 |
0.1 mL |
539.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18601986
|
Novus Biologicals
NBP2-38402-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
bcl10-interacting CARD protein Polyclonal specifically detects bcl10-interacting CARD protein in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| bcl10-interacting CARD protein | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Q96LW7 | |
| 84270 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVR | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Protein Kinase | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| bA370F5.1, bcl10-interacting CARD protein, Bcl10-interacting protein with CARD, BinCARD, chromosome 9 open reading frame 89, MGC110898, MGC11115 | |
| CARD19 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title