missing translation for 'onlineSavingsMsg'
Learn More
Learn More
beta-1,3-Glucuronyltransferase 3/B3GAT3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59853
This item is not returnable.
View return policy
Description
beta-1,3-Glucuronyltransferase 3/B3GAT3 Polyclonal specifically detects beta-1,3-Glucuronyltransferase 3/B3GAT3 in Human samples. It is validated for Western Blot.
Specifications
| beta-1,3-Glucuronyltransferase 3/B3GAT3 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Beta-1,3-glucuronyltransferase 3, beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I), EC 2.4.1.135, galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3, GlcAT-I, GLCATI, GlcUAT-I, Glucuronosyltransferase I, Sqv-8-like protein, UDP-GlcUA:Gal beta-1,3-Gal-R glucuronyltransferase | |
| Rabbit | |
| 37 kDa | |
| 100 μL | |
| metabolism | |
| 26229 | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O94766 | |
| B3GAT3 | |
| Synthetic peptides corresponding to B3GAT3 (beta-1,3-glucuronyltransferase 3 (glucuronosyltransferase I)) The peptide sequence was selected from the N terminal of B3GAT3)(50ug). Peptide sequence PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction