missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BOLA2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
463.00€
Specifications
| Antigen | BOLA2 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
BOLA2 Polyclonal specifically detects BOLA2 in Mouse samples. It is validated for Western Blot.Specifications
| BOLA2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| BolA Homolog 2B (E. Coli), BOLA2, BOLA2A, BOLA2B, BolA-Like 2B, BolA-Like 2B (E. Coli), BolA-Like Protein 2, BolA-Like Protein 2 Member B, BolA-Like Protein 2B | |
| The immunogen is a synthetic peptide directed towards the n terminal region of mouse BOLA2 (NP_780312). Peptide sequence MELSADYLREKLRQDLEAEHVEVEDTTLNRCATSFRVLVVSAKFEGKPLL | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 654483 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title