missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C12orf73 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
267.00€ - 557.00€
Specifications
| Antigen | C12orf73 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500, Knockout Validated, KnockDown Validated |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18471872
|
Novus Biologicals
NBP1-90536-25ul |
25 μL |
267.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18254597
|
Novus Biologicals
NBP1-90536 |
0.1 mL |
557.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
C12orf73 Polyclonal specifically detects C12orf73 in Human, Zebrafish samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockout Validated, Knockdown Validated.Specifications
| C12orf73 | |
| Polyclonal | |
| Rabbit | |
| Human, Zebrafish | |
| BR, BRAWNIN, chromosome 12 open reading frame 73, FLJ13975, protein BRAWNIN, uncharacterized protein C12orf73 | |
| C12ORF73 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500, Knockout Validated, KnockDown Validated | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 728568 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:AEVVHRYYRPDLTIPEIPPKRGELKTELLGLKERKHKPQVSQQEEL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title