missing translation for 'onlineSavingsMsg'
Learn More
Learn More
C1orf216 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
483.00€
Specifications
| Antigen | C1orf216 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
C1orf216 Polyclonal specifically detects C1orf216 in Mouse samples. It is validated for Western Blot.Specifications
| C1orf216 | |
| Polyclonal | |
| Rabbit | |
| Q8BP99 | |
| 127703 | |
| Synthetic peptides corresponding to the C terminal of 5730409E04Rik. Immunizing peptide sequence RLALLQWIRALQHQLVDQQARLQESFDTILDNRKELIRCLQQREAPCRHQ. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 1 open reading frame 216, FLJ38984, hypothetical protein LOC127703 | |
| C1orf216 | |
| IgG | |
| 25 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title