missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18252415

Novus Biologicals™ calmodulin-lysine N-methyltransferase Recombinant Protein Antigen

Product Code. 18252415 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
Product Code. Quantity unitSize
18252415 100 μL 100µL
1 options
This item is not returnable. View return policy

Product Code. 18252415

Brand: Novus Biologicals™ NBP257496PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human calmodulin-lysine N-methyltransferase. Source: E.coli Amino Acid Sequence: SEEVLAYYCLKHNNIFRALAVCELGGGMTCLAGLMVAISADVKEVLLTDGNEKAIRNVQDIITRNQKAGVFKTQKISSCVLRWDNETDVSQLEG The calmodulin-lysine N-methyltransferase Recombinant Protein Antigen is derived from E. coli. The calmodulin-lysine N-methyltransferase Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 79823
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name calmodulin-lysine N-methyltransferase Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias C2orf34, calmodulin methyltransferase, calmodulin-lysine N-methyltransferase, Cam, CaM KMT, chromosome 2 open reading frame 34, CLNMTFLJ23451, EC 2.1.1.60, KMT
Gene Symbol CAMKMT
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-53063. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For Research Use Only.

Product Title
Select an issue

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.