missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CCL28 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-69040-25ul
This item is not returnable.
View return policy
Description
CCL28 Polyclonal antibody specifically detects CCL28 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Spécification
| CCL28 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| chemokine (C-C motif) ligand 28, member 28, MGC71902, Protein CCK1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVS | |
| 25 μL | |
| Biologically Active Proteins | |
| 56477 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu