missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CD21 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
359.00€ - 549.00€
Specifications
| Antigen | CD21 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18645775
|
Novus Biologicals
NBP2-38895-25ul |
25 μL |
359.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18180288
|
Novus Biologicals
NBP2-38895 |
0.1 mL |
549.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CD21 Polyclonal specifically detects CD21 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CD21 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| P20023 | |
| 1380 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Adaptive Immunity, Dendritic Cell Markers, Immunology | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| C3DRSLEB9, CD21, CD21 antigen, Complement C3d receptor, complement component (3d/Epstein Barr virus) receptor 2, complement receptor type 2, Cr2, EBV receptor, Epstein-Barr virus receptor | |
| CR2 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title