missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Cdc6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Specifications
| Antigen | Cdc6 |
|---|---|
| Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18695196
|
Novus Biologicals
NBP2-68827-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18664546
|
Novus Biologicals
NBP2-68827 |
100 μg |
593.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Cdc6 Polyclonal antibody specifically detects Cdc6 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
| Cdc6 | |
| Immunofluorescence | |
| Unconjugated | |
| Rabbit | |
| Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol | |
| 990 | |
| IgG | |
| Protein A purified |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| CDC18LHsCDC18, Cdc18-related protein, CDC6 (cell division cycle 6, S. cerevisiae) homolog, CDC6 cell division cycle 6 homolog, CDC6 cell division cycle 6 homolog (S. cerevisiae), CDC6-related protein, cell division control protein 6 homolog, cell division cycle 6 homolog (S. cerevisiae), cell division cycle 6 protein, HsCdc18, HsCDC6, p62(cdc6) | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title