missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CEACAM1/CD66a Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-85743
This item is not returnable.
View return policy
Description
CEACAM1/CD66a Polyclonal specifically detects CEACAM1/CD66a in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| CEACAM1/CD66a | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| antigen CD66, BGP-1, BGP1BGPBiliary glycoprotein 1, BGPI, biliary glycoprotein adhesion molecule, carcinoembryonic antigen-related cell adhesion molecule 1, carcinoembryonic antigen-related cell adhesion molecule 1 (biliaryglycoprotein), CD66a, CD66a antigen | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CEACAM1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE | |
| 0.1 mL | |
| Apoptosis, Cancer | |
| 634 | |
| Human | |
| IgG |
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur