missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ChGn Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
280.00€ - 624.00€
Specifications
| Antigen | ChGn |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18250855
|
Novus Biologicals
NBP2-56242 |
100 μL |
624.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607326
|
Novus Biologicals
NBP2-56242-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ChGn Polyclonal specifically detects ChGn in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ChGn | |
| Unconjugated | |
| RUO | |
| Human | |
| beta4GalNAcT, Beta4GalNAcT-1, CHGN, chondroitin beta1,4 N-acetylgalactosaminyltransferase, Chondroitin beta-1,4-N-acetylgalactosaminyltransferase 1, chondroitin sulfate N-acetylgalactosaminyltransferase 1, CSGalNAcT-1, EC 2.4.1.174, FLJ11264, FLJ13760, GALNACT1 | |
| CSGALNACT1 | |
| IgG | |
| Affinity Purified |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 55790 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YMLACTPKGDEEQLALPRANSPTGKEGYQAVLQEWEEQHRNYVSSLKRQIA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title