missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CIZ1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
280.00€ - 539.00€
Specifications
| Antigen | CIZ1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18453432
|
Novus Biologicals
NBP2-33890-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18148373
|
Novus Biologicals
NBP2-33890 |
0.1 mL |
539.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
CIZ1 Polyclonal specifically detects CIZ1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CIZ1 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CDKN1A interacting zinc finger protein 1, CDKN1A-interacting zinc finger protein 1, cip1-interacting zinc finger protein, LSFR1ZNF356Nuclear protein NP94, NP94, Zinc finger protein 356 | |
| CIZ1 | |
| IgG | |
| Affinity Purified | |
| Specificity of human CIZ1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse | |
| Q9ULV3 | |
| 25792 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title