missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Collagen I alpha 1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-82488-25ul
This item is not returnable.
View return policy
Description
Collagen I alpha 1 Polyclonal specifically detects Collagen I alpha 1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| Collagen I alpha 1 | |
| Polyclonal | |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P02452 | |
| COL1A1 | |
| This Collagen I alpha 1 antibody was developed against Recombinant Protein corresponding to amino acids: DRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGP | |
| Affinity Purified | |
| RUO | |
| Primary | |
| The specificity of this human Collagen I alpha 1 antibody was verified on a Protein Array containing the target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Alpha-1 type I collagen, COL-IA1, Collagen 1, Collagen 1 alpha 1, collagen alpha 1 chain type I, collagen alpha-1(I) chain, collagen of skin, tendon and bone, alpha-1 chain, Collagen Type I Alpha 1 Chain, collagen, type I, alpha 1, Collagen1, Collagen-1, EDSARTH1, OI4, pro-alpha-1 collagen type 1, Type I Procollagen Alpha 1 Chain | |
| Rabbit | |
| 139 kDa | |
| 25 μL | |
| Cell Biology, Cellular Markers, Extracellular Matrix, Signal Transduction, Stem Cells | |
| 1277 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction