missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Connexin 46/GJA3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
415.00€ - 572.00€
Specifications
| Antigen | Connexin 46/GJA3 |
|---|---|
| Dilution | Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18264513
|
Novus Biologicals
NBP2-58660 |
100 μL |
572.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18698877
|
Novus Biologicals
NBP2-58660-25ul |
25 μL |
415.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Connexin 46/GJA3 Polyclonal specifically detects Connexin 46/GJA3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Connexin 46/GJA3 | |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| CAE3, connexin 46, connexin-46, Cx46, CX46gap junction alpha-3 protein, CZP3, gap junction protein, alpha 3, 46kD (connexin 46), gap junction protein, alpha 3, 46kDa, gap junction protein, alpha 3, 46kDa (connexin 46) | |
| GJA3 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 2700 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEEKKKEREEEEQLKRESPSPKEPPQDNPSSRDDRGRVRMAG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title