missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COP9 signalosome complex subunit 2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Specifications
| Antigen | COP9 signalosome complex subunit 2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18256703
|
Novus Biologicals
NBP2-58587 |
100 μL |
593.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18666088
|
Novus Biologicals
NBP2-58587-25ul |
25 μL |
369.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
COP9 signalosome complex subunit 2 Polyclonal specifically detects COP9 signalosome complex subunit 2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| COP9 signalosome complex subunit 2 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, Neuronal Cell Markers, Neurotransmission, Signal Transduction | |
| ALIEN, Alien homolog, COP9 constitutive photomorphogenic homolog subunit 2 (Arabidopsis), COP9 signalosome complex subunit 2, CSN2JAB1-containing signalosome subunit 2, SGN2TR-interacting protein 15, Signalosome subunit 2, thyroid receptor interacting protein 15, Thyroid receptor-interacting protein 15, TRIP15TRIP-15 | |
| COPS2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 9318 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ISTSKQNSDFLCQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title