missing translation for 'onlineSavingsMsg'
Learn More
Learn More
COX10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
433.00€ - 572.00€
Specifications
| Antigen | COX10 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18443111
|
Novus Biologicals
NBP1-86323-25ul |
25 μL |
433.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18201276
|
Novus Biologicals
NBP1-86323 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
COX10 Polyclonal specifically detects COX10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| COX10 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1352 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:PNEKELIELEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| COX10 (yeast) homolog, cytochrome c oxidase assembly protein (heme A:farnesyltransferase), COX10 homolog, cytochrome c oxidase assembly protein, heme A:farnesyltransferase (yeast), cytochrome c oxidase assembly protein, cytochrome c oxidase subunit X, EC 2.5.1.-, heme A: farnesyltransferase, Heme O synthase, protoheme IX farnesyltransferase, mitochondrial | |
| COX10 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto