missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Desmocollin-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
280.00€ - 624.00€
Specifications
| Antigen | Desmocollin-3 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18426911
|
Novus Biologicals
NBP2-31886-25ul |
25 μL |
280.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18167573
|
Novus Biologicals
NBP2-31886 |
0.1 mL |
624.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Desmocollin-3 Polyclonal specifically detects Desmocollin-3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| Desmocollin-3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Cadherin family member 3, CDHF3HT-CP, desmocollin 3, desmocollin-4, DSC, DSC1, DSC2, DSC4desmocollin-3 | |
| DSC3 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q14574 | |
| 1825 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VTDSNDNAPTFRQNAYEAFVEENAFNVEILRIPIEDKDLINT | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title