missing translation for 'onlineSavingsMsg'
Learn More
Learn More
EXOC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-55430
This item is not returnable.
View return policy
Description
EXOC6 Polyclonal specifically detects EXOC6 in Human, Mouse samples. It is validated for Western Blot.
Specifications
| EXOC6 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| DKFZp761I2124, EXOC6A, exocyst complex component 6, Exocyst complex component Sec15A, FLJ1125, FLJ11251, MGC33397, SEC15A, SEC15L1SEC15-like 1 (S. cerevisiae), SEC15L3, SEC15-like 1, SEC15-like protein 1, SEC15-like protein 3, SEC15LSEC15, Sec15p | |
| Rabbit | |
| 88 kDa | |
| 100 μL | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| B3KXY5 | |
| EXOC6 | |
| Synthetic peptides corresponding to EXOC6(exocyst complex component 6) Antibody(against the N terminal of EXOC6. Peptide sequence MLEEETDQTYENVLAEIQSFELPVEATLRSVYDDQPNAHKKFMEKLDACI. | |
| Affinity purified | |
| RUO | |
| 54536 | |
| Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction