missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FAM110A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56326
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
FAM110A Polyclonal specifically detects FAM110A in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Spécification
| FAM110A | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| bA371L19.3, C20orf55, chromosome 20 open reading frame 55, F10, family with sequence similarity 110, member A, hypothetical protein LOC83541, MGC2450, MGC4675 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 83541 | |
| Human | |
| IgG |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| FAM110A | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPVHTLSPGAPSAPALPCRLRTRVPGYLLRGPADGGARKPSAVE | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu