missing translation for 'onlineSavingsMsg'
Learn More
Learn More
FANCD2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57171-25ul
This item is not returnable.
View return policy
Description
FANCD2 Polyclonal specifically detects FANCD2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| FANCD2 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| DKFZp762A223, FA4, FACD, FAD, FAD2, FA-D2, FADFAD2, FANCD, Fanconi anemia complementation group D2, Fanconi anemia group D2 protein, Fanconi anemia, complementation group D2, FLJ23826, FPN1, HFE4, IREG1, Protein FACD2, SLC11A3 | |
| Rabbit | |
| 164.1 kDa | |
| 25 μL | |
| Breast Cancer, Cancer, DNA Double Strand Break Repair, DNA Repair, Epigenetics, Genes Sensitive to DNA Damaging Agents | |
| 2177 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| FANCD2 | |
| This FANCD2 Antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction