missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Flt-3/Flk-2/CD135 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
302.00€ - 498.00€
Specifications
| Antigen | Flt-3/Flk-2/CD135 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18252001
|
Novus Biologicals
NBP2-57187 |
100 μL |
498.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18699466
|
Novus Biologicals
NBP2-57187-25ul |
25 μL |
302.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Flt-3/Flk-2/CD135 Polyclonal specifically detects Flt-3/Flk-2/CD135 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| Flt-3/Flk-2/CD135 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 2322 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PGIPVDANFYKLIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDGRVSECPHTYQNRRPFSREMDLGLLS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| CD135, CD135 antigen, EC 2.7.10, fetal liver kinase 2, FL cytokine receptor, FLK2, FLT-3, FLT3 receptor tyrosine kinase, Fms-like tyrosine kinase 3, fms-related tyrosine kinase 3, growth factor receptor tyrosine kinase type III, Stem cell tyrosine kinase 1, STK-1, STK1EC 2.7.10.1, Tyrosine-protein kinase receptor FLT3 | |
| FLT3 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title