missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Fucosyltransferase 8/FUT8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
359.00€ - 515.00€
Specifications
| Antigen | Fucosyltransferase 8/FUT8 |
|---|---|
| Dilution | Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Fucosyltransferase 8/FUT8 Polyclonal specifically detects Fucosyltransferase 8/FUT8 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Fucosyltransferase 8/FUT8 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| alpha-(1,6)-fucosyltransferase, alpha1-6FucT, EC 2.4.1.68, Fucosyltransferase 8, fucosyltransferase 8 (alpha (1,6) fucosyltransferase), GDP-fucose--glycoprotein fucosyltransferase, GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase, Glycoprotein 6-alpha-L-fucosyltransferase, MGC26465 | |
| FUT8 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q9BYC5 | |
| 2530 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: WSGEVKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEATKKLGFKHPVIGVHVRRTD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title