missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GAPDH Antibody (CL3265), Novus Biologicals™
Mouse Monoclonal Antibody
294.00€ - 549.00€
Specifications
| Antigen | GAPDH |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18233894
|
Novus Biologicals
NBP2-59025 |
100 μL |
549.00€
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18609526
|
Novus Biologicals
NBP2-59025-25ul |
25 μL |
294.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
GAPDH Monoclonal specifically detects GAPDH in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| GAPDH | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| 2597 | |
| This GAPDH antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 1:500 - 1:1000, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated | |
| Unconjugated | |
| Mouse | |
| Alzheimers Research, Apoptosis, Autophagy, Cancer, DNA Repair, Lipid and Metabolism, Loading Controls, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Nuclear Receptors Coactivators and Corepressors, Signal Transduction, Translation Control | |
| aging-associated gene 9 protein, EC 1.2.1, EC 1.2.1.12, EC 2.6.99.-, G3PD, GAPD, glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, MGC88685, Peptidyl-cysteine S-nitrosylase GAPDH | |
| GAPDH | |
| IgG1 | |
| Protein A purified | |
| 36 kDa |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title