missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Histone H1T Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-57668
This item is not returnable.
View return policy
Description
Histone H1T Polyclonal specifically detects Histone H1T in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Histone H1T | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| dJ221C16.2, H1 histone family, member T (testis-specific), H1FTMGC163222, H1t, histone 1, H1t, histone cluster 1, H1t, histone H1t, Testicular H1 histone | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| HIST1H1T | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMS | |
| 100 μL | |
| Epigenetics, Histones and Modified Histones | |
| 3010 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction