missing translation for 'onlineSavingsMsg'
Learn More
Learn More
HRSP12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
433.00€ - 572.00€
Specifications
| Antigen | HRSP12 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18463691
|
Novus Biologicals
NBP1-82453-25ul |
25 μL |
433.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18237155
|
Novus Biologicals
NBP1-82453 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
HRSP12 Polyclonal specifically detects HRSP12 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| HRSP12 | |
| Polyclonal | |
| Rabbit | |
| Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10247 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MSSLIRRVISTAKAPGAIGPYSQAVLVDRTIYISGQIGMDPSSGQLVSGGVAEEAKQALKNMGEILKAA | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Rat | |
| EC 3.1, heat-responsive protein 12perchloric acid-soluble protein, P14.5, PSPribonuclease UK114, translational inhibitor protein p14.5,14.5 kDa translational inhibitor protein, UK114 antigen homolog, UK114translational inhibitor p14.5 | |
| HRSP12 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title