Learn More
Invitrogen™ HTR2A Polyclonal Antibody

Rabbit Polyclonal Antibody
Brand: Invitrogen™ PA595288
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Rat Testis Tissue, U87 whole cell. IHC: human glioma tissue, rat brain tissue. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
In platelets and gut, serotonin plays a major role in cardiovascular function and motility of the gastrointestinal tract, respectively. Serotonin mediates its effects through several of G protein coupled receptors, designated 5-HT receptors or alternatively SR receptors. The SR-2 receptors are comprised of three subtypes, SR-2A, SR-2B and SR-2C, which activate phospholipase C and release intracellular stores of calcium in response to serotonin. SR-2A has a specific role in tracheal smooth muscle contraction, bronchoconstriction and mediating aldosterone production, and it is also thought to play a role in several psychiatric disorders, including depression and schizophrenia. SR-2B is expressed in embryonic and adult cardiovascular tissues, gut and brain and plays an important role in the pathology of cardiac disorders. SR-2C is thought to mediate the effects of atypical antipsychotic drugs.
Specifications
| HTR2A | |
| Polyclonal | |
| Unconjugated | |
| Htr2a | |
| 5-HT-2; 5Ht-2; 5-HT2 receptor; 5-HT2A; 5-HT-2A; 5HT2A Receptor; 5-HT2A receptor; 5-HT2A/2C; 5-HT2A/2C receptor; 5-hydroxytryptamine (serotonin) receptor 2A; 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled; 5-hydroxytryptamine 2 receptor; 5-hydroxytryptamine receptor 2A; E030013E04; Htr2; Htr-2; HTR2A; serotonin 5HT-2 receptor; serotonin 5-HT-2A receptor; serotonin receptor 2A; SR2A | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 29595, 3356 | |
| -20°C | |
| Lyophilized |
| Immunohistochemistry (Paraffin), Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| P14842, P28223 | |
| Htr2a | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) . | |
| 100 μg | |
| Primary | |
| Human, Rat | |
| Antibody | |
| IgG |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.