missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209680

Invitrogen™ Human CD11c (aa 596-705) Control Fragment Recombinant Protein

Product Code. 30209680
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209680 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209680 Supplier Invitrogen™ Supplier No. RP88636

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110685 (PA5-110685. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD11, along with CD18, form a heterodimer adhesion molecule. In particular, CD11 is composed of CD11a, CD11b and CD11c. CD11a is a leukocyte marker that is expressed in B and T lymphocytes, macrophages, monocytes, neutrophils, basophils and eosinophils. CD11b is primarily expressed by monocytes, macrophages, natural killer cells, some B and T-cells, and granulocytes. CD11c is expressed in monocytes, macrophages, natural killer cells, some granulocytes and less so in a subset of lymphocytes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P20702
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3687
Name Human CD11c (aa 596-705) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI449405; CD11 antigen-like family member C; CD11c; CD11C (p150) alpha polypeptide; complement component 3 receptor 4 subunit; complement receptor 4; Cr4; integrin alpha X; integrin alpha-X; integrin aX; integrin subunit alpha X; integrin, alpha X; integrin, alpha x (antigen CD11C (p150), alpha polypeptide); integrin, alpha x (complement component 3 receptor 4 subunit); Itgax; Leu M5; leu M5, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; Leukocyte adhesion receptor p150,95; leukocyte surface antigen p150,95, alpha subunit; myeloid membrane antigen, alpha subunit; N418; p150 95 integrin alpha chain; RGD1561123; SLEB6
Common Name CD11c
Gene Symbol Itgax
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.