missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human CYP2D6 (aa 196-273) Control Fragment Recombinant Protein

Product Code. 30209109
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30209109 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30209109 Supplier Invitrogen™ Supplier No. RP100044

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83766 (PA5-83766. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cytochrome p450 2D6 (CYP2D6) is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P10635
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1565
Name Human CYP2D6 (aa 196-273) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI303445; Cholesterol 25-hydroxylase; CPD6; CYP2D; Cyp2d10; Cyp2d-10; Cyp2d13; Cyp2d18; Cyp2d-18; Cyp2d22; Cyp2d3; Cyp2d-3; Cyp2d4; Cyp2d-4; Cyp2d4v1; Cyp2d4v2; Cyp2d6; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID10; CYPIID18; CYPIID3; CYPIID4; CYPIID6; Cytochrome P450 2D10; cytochrome P450 2d18; Cytochrome P450 2 D-29; Cytochrome P450 2D3; cytochrome P450 2 D-35; cytochrome P450 2D4; Cytochrome P450 2D6; cytochrome P450 family 2 subfamily D member 6; cytochrome P450, 2d10; cytochrome P450, family 2, subfamily d, polypeptide 10; cytochrome P450, family 2, subfamily d, polypeptide 13; cytochrome P450, family 2, subfamily d, polypeptide 22; cytochrome P450, family 2, subfamily d, polypeptide 3; cytochrome P450, family 2, subfamily d, polypeptide 4; cytochrome P450, family 2, subfamily d, polypeptide 6; cytochrome P450, family 2, subfamily D, polypeptide 7 pseudogene 2; cytochrome P450, family 2, subfamily D, polypeptide 8 pseudogene 2; cytochrome P450, subfamily 2 D, polypeptide 6; cytochrome P450, subfamily II (debrisoquine, sparteine, etc., -metabolising), polypeptide 7 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolising), polypeptide 8 pseudogene 2; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing), polypeptide 6; cytochrome P450, subfamily IID (debrisoquine, sparteine, etc., -metabolizing)-like 1; cytochrome P450, subfamily IID, polypeptide 6; Cytochrome P450, subfamily IID3; Cytochrome P450, subfamily IID4; cytochrome P450-16-alpha; Cytochrome P450CB; Cytochrome P450-CMF3; cytochrome P450-DB1; Cytochrome P450-DB3; cytochrome P450-DB4; debrisoquine 4-hydroxylase; flavoprotein-linked monooxygenase; microsomal monooxygenase; nonfunctional cytochrome P450 2D6; P450 2 D-29/2 D-35; P450-2 D; P450C2D; P450-CMF3; P450DB1; P450-DB1; P450-DB3; P450-DB4; testosterone 16-alpha hydroxylase; xenobiotic monooxygenase
Common Name CYP2D6
Gene Symbol CYP2D6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.