missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30206368

Invitrogen™ Human IFN beta (aa 24-101) Control Fragment Recombinant Protein

Product Code. 30206368
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30206368 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30206368 Supplier Invitrogen™ Supplier No. RP109371

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (45%), Rat (45%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Type I Interferons (IFN-alpha/beta) are produced primarily in response to viral infection by Natural IFN-producing cells (IPCs) as part of the host immune response. IFNs can also inhibit the development of tumors. IFN-beta binding results in the activation of the tyrosine kinases Jak1 and Tyk2, phosphorylation of members of the STAT family of transcription factors, and the transcription and expression of the immune response genes. More recently, several members of the toll-like receptor (TLR) family were found to stimulate the production IFN-beta. IFN-beta is currently used clinically for treatment of tumors, infections and multiple sclerosis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P01574
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3456
Name Human IFN beta (aa 24-101) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Fibroblast interferon; Ifb; IFF; IFN b; IFN β; IFNB; Ifnb1; IFNbeta; IFN-beta; IFNβ; Interferon; Interferon b; Interferon beta; interferon beta 1; interferon beta 1, fibroblast; interferon beta protein; interferon, beta 1; interferon, beta 1, fibroblast; interferon-beta; RP11-113D19.1
Common Name IFN beta
Gene Symbol Ifnb1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.