missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203013

Invitrogen™ Human NELF (aa 394-511) Control Fragment Recombinant Protein

Product Code. 30203013
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30203013 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30203013 Supplier Invitrogen™ Supplier No. RP93053

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60674 (PA5-60674. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NELF (nasal embryonic luteinizing hormone-releasing hormone factor) is a 530 amino acid transcription factor involved in the migration of LHRH neurons, outgrowth of olfactory axons and suppression of transcription elongation. NELF is found in the peripheral and central nervous system during embryonic development, and is highly expressed in adult testis, kidney and brain. Known to couple NMDA receptor signaling to the nucleus, NELF knockdown impaired GnRH neuronal migration of NLT cells in vitro and the gene encoding NELF has been linked to the development of Idiopathic hypogonadotropic hypogonadism (IHH), a disorder resulting in impaired pubertal maturation and reproductive function.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6X4W1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 26012
Name Human NELF (aa 394-511) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias HH9; Jac; Jacob; Jacob protein; Juxtasynaptic attractor of caldendrin on dendritic boutons protein; nasal embryonic LHRH factor; Nasal embryonic luteinizing hormone-releasing hormone factor; NELF; NMDA receptor synaptonuclear signaling and neuronal migration factor; NSMF
Common Name NELF
Gene Symbol NSMF
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLNVYHKGAKIWKMLIFCQGGPGHLYLLKNKVATFAKVEKEEDMIHFWKRLSRLMSKVNPEPNVIHIMGCYILGNPNGEKLFQNLRTLMTPYRVTFESPLELSAQGKQMIETYFDFRL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.