missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30181592

Invitrogen™ Human NFkB p50/p105 (aa 396-538) Control Fragment Recombinant Protein

Product Code. 30181592
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30181592 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30181592 Supplier Invitrogen™ Supplier No. RP99391

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

NF-kB is a nuclear transcription factor activated by various extra and intracellular stimuli such as cytokines, UV radiation, stress, in injury, and by bacterial and viral products. It is involved in regulation of various cellular events including cell growth, differentiation, proliferation, apoptosis and inflammation. NFKB1 (p50), a 50KDa functional sub-unit of NF-kB, is a member of Rel protein family. It is synthesized as a p105 precursor protein and consists of an N-terminal conserved RHD-region containing nuclear localization signal, DNA-binding and dimerization domains. NFKB1 (p50) forms homodimers or heterodimerizes with p65, forming the functional NF-kB factor. NFKB1 (p50) directs the nuclear translocation of NF-kB and is instrumental in its DNA-bidning. Pathological role of NF-kB has been suggested in AIDS, hematogenic cancer cell metastasis and rheumatoid arthritis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P19838
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 4790
Name Human NFkB p50/p105 (aa 396-538) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CVID12; DKFZp686C01211; DNA-binding factor KBF1; EBP-1; KBF1; MGC54151; NF kappaB1; NF KB; NFkappaB; NF-kappaB; NF-kappa-B; NF-kappaB p50; NF-kappaB1; NF-kappa-B1 p84/NF-kappa-B1 p98; NF-kappabeta; NF-kB; NF-kB p50/p105; NFKB1; NF-KB1; NFKB-p105; NFKB-p50; nuclear factor; nuclear factor kappa b; nuclear factor kappa B subunit 1; nuclear factor kappa-B DNA binding subunit; nuclear factor kappaB p50; nuclear factor NF-kappa-B p105 subunit; Nuclear factor NF-kappa-B p50 subunit; nuclear factor of kappa light chain gene enhancer in B-cells 1, p105; nuclear factor of kappa light polypeptide gene enhancer in B cells 1, p105; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1; nuclear factor of kappa light polypeptide gene enhancer in B-cells 1, p105; nuclear factor-kappaB p50; p105; p50; p50 subunit of NF kappaB; p50 subunit of NF-kappaB; p50/p105
Common Name NFkB p50/p105
Gene Symbol NFKB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGEVTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.