missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30182117

Invitrogen™ Human PIGU (aa 111-164) Control Fragment Recombinant Protein

Product Code. 30182117
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30182117 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30182117 Supplier Invitrogen™ Supplier No. RP99351

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59685 (PA5-59685. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of the GPI transamidase complex. May be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H490
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 128869
Name Human PIGU (aa 111-164) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5430426F17Rik; BC028278; CDC91 (cell division cycle 91, S. cerevisiae, homolog)-like 1; CDC91 cell division cycle 91-like 1; CDC91L1; cell division cycle 91-like 1; cell division cycle 91-like 1 protein; cell division cycle protein 91-like 1; GAB1; GPI transamidase component PIG-U; GPI transamidase subunit; liver regeneration-related protein LRRGT00059; phosphatidylinositol glycan anchor biosynthesis class U; phosphatidylinositol glycan anchor biosynthesis class U protein; phosphatidylinositol glycan anchor biosynthesis, class U; phosphatidylinositol-glycan biosynthesis, class U protein; Pigu; Protein CDC91-like 1; PSEC0205; sakura; UNQ3055/PRO9875
Common Name PIGU
Gene Symbol PIGU
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSCVAKSTCAINN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.