missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PPP1R10 (aa 201-295) Control Fragment Recombinant Protein

Product Code. 30212928
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30212928 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30212928 Supplier Invitrogen™ Supplier No. RP103005

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61475 (PA5-61475. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RNA polymerases transcribe nuclear genes for ribosomal RNA, thus representing ribosomal biogenesis. RNA polymerase I (Pol I) is located in the nucleolus and transcribes class I genes, which code for large ribosomal RNA. Different subunits of the Pol I transcription machinery are targets of various physiological stimuli, which suggests that multiple signaling pathways are involved in carrying out Pol I transcription. RPA40 and RPA16 are subunits of Pol I that associate with each other at an early stage of RNA polymerase I assembly. RPA40 is essential for the function and integrity of the complex and is also an essential subunit of RNA polymerase III (Pol III). RPA40, RPA16 and RPA135 encode the three subunits of RNA polymerase I, respectively. RPA194 is the largest subunit of RNA Pol I and is not a component of Pol II and Pol III.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96QC0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5514
Name Human PPP1R10 (aa 201-295) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610025H06Rik; Cat53; D17Ertd808e; Fb19; HLA-C adjacent transcript 53; HLA-C associated transcript 53; MHC class I region proline-rich protein CAT53; p99; Phosphatase 1 nuclear targeting subunit; Pnuts; PNUTSPP1R10; PP1-binding protein of 114 kDa; PP1R10; PPP1R10; Protein FB19; protein phosphatase 1 regulatory subunit 10; protein phosphatase 1, regulatory (inhibitor) subunit 10; protein phosphatase 1, regulatory subunit 10; protein phosphatase I; Protein PNUTS; putative protein phosphatase 1 nuclear targeting subunit; R111; Serine/threonine-protein phosphatase 1 regulatory subunit 10; testis tissue sperm-binding protein Li 67 n
Common Name PPP1R10
Gene Symbol PPP1R10
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKPIPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDAL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.