missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196613

Invitrogen™ Human RNASE7 Control Fragment Recombinant Protein

Product Code. 30196613
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30196613 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30196613 Supplier Invitrogen™ Supplier No. RP88942

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52184. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The RNASE7 gene encodes a ribonuclease enzyme characterized by its potent ribonucleolytic activity and antimicrobial properties. It is part of the RNase A superfamily, featuring eight conserved cysteines and a catalytic histidine-lysine-histidine triad. RNase 7 is expressed in various somatic tissues, including the liver, kidney, skeletal muscle, and heart, and is prominently found in the stratum corneum of human skin. Its role is crucial in innate immune defense, assisting in the high resistance of human skin against infections. The expression of RNASE7 can be significantly induced by pro-inflammatory cytokines such as interferon-gamma, interleukin 1 beta, and to a lesser extent by tumor necrosis factor-a. This induction highlights its role in immune responses. Beyond its antimicrobial activity, RNase 7 has been shown to play a role in translating self-nucleic acids into TLR9 activators, influencing the DNA-mediated activation of immune cells like keratinocytes. These functions underscore RNASE7's significance in both maintaining skin barrier function and modulating immune responses.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9H1E1
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 84659
Name Human RNASE7 Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias RAE1; Ribonuclease 7; ribonuclease A family member 7; ribonuclease, RNase A family, 7; RNase 7; RNASE7; SAP-2; skin-derived antimicrobial protein 2; UNQ2516/PRO6006
Common Name RNASE7
Gene Symbol RNASE7
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGPVSLTMCKLTSGKYPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.