missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210085

Invitrogen™ Human SLC6A18 (aa 312-394) Control Fragment Recombinant Protein

Product Code. 30210085
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30210085 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30210085 Supplier Invitrogen™ Supplier No. RP89580

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52865 (PA5-52865. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The solute carrier (SLC) family, also known as the neurotransmitter transporter family, is one of the largest transporter families in the human genome. The SLC6 subgroup, which includes the dopamine transporter (DAT), the serotonin transporter (SERT) and the norepinephrine transporter (NET), contains sodium/chloride dependent, high-affinity plasma transport proteins. Sodium/chloride-dependent transporter XTRP2, also known as solute carrier family 6 member 18 (SLC6A18), is a 628 amino acid member of the SLC family. XTRP2 is composed of 12 exons, 11 introns and 8 tandem repeats. Highly expressed in the kidney, SLC6A18 is classified as an orphan transporter.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96N87
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 348932
Name Human SLC6A18 (aa 312-394) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias b(0)AT3; B0AT3; D630001K16Rik; FLJ31236; Inactive sodium-dependent neutral amino acid transporter B(0)AT3; renal osmotic stress-induced Na-Cl organic solute cotransporter; Rosit; Slc6a18; sodium and chloride dependent transporter Xtrp2; sodium- and chloride-dependent transporter XTRP2; sodium channel-like protein; Sodium-dependent neutral amino acid transporter B(0)AT3; solute carrier family 6 (neurotransmitter transporter), member 18; solute carrier family 6 (neutral amino acid transporter), member 18; solute carrier family 6 member 18; solute carrier family 6, member 18; system B 0 neutral amino acid transporter AT3; system B(0) neutral amino acid transporter AT3; x transporter protein 2; Xt2; Xtrp2
Common Name SLC6A18
Gene Symbol SLC6A18
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.