missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204189

Invitrogen™ Human TMEM204 (aa 192-226) Control Fragment Recombinant Protein

Product Code. 30204189
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30204189 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30204189 Supplier Invitrogen™ Supplier No. RP90756

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53112 (PA5-53112. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transmembrane protein 204 (TMEM204) is a four-transmembrane protein that is induced under hypoxic conditions. It localizes to cell-cell junctions and co-localizes with the beta-catenin adherens junction-associated protein, but not with tight junctions. Overexpression of TMEM204 results in decreased adhesion between cells, indicating that TMEM204 is an adherens junction protein that modulates cell adhesion and potentially angiogenesis. Recent evidence suggests TMEM204 may also be involved in epilepsy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BSN7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79652
Name Human TMEM204 (aa 192-226) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C16orf30; Claudin-like protein 24; claudin-like protein of 24 kDa; Clp24; Tmem204; Transmembrane protein 204; UNQ6509/PRO21434
Common Name TMEM204
Gene Symbol TMEM204
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.