missing translation for 'onlineSavingsMsg'
Learn More
Learn More
IL-1 RAcP/IL-1 R3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00€ - 572.00€
Specifications
| Antigen | IL-1 RAcP/IL-1 R3 |
|---|---|
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18433011
|
Novus Biologicals
NBP1-86793 |
0.1 mL |
572.00€
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18403231
|
Novus Biologicals
NBP1-86793-25ul |
25 μL |
292.00€
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
IL-1 RAcP/IL-1 R3 Polyclonal antibody specifically detects IL-1 RAcP/IL-1 R3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| IL-1 RAcP/IL-1 R3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cytokine Research, Immunology | |
| PBS (pH 7.2) and 40% Glycerol | |
| 3556 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| C3orf13IL-1RAcPIL1R3Interleukin-1 receptor 3, FLJ37788, IL-1 receptor accessory protein, IL-1R3, IL-1R-3, interleukin 1 receptor accessory protein, interleukin-1 receptor accessory protein, interleukin-1 receptor accessory protein beta | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: CRCCVTYCEGENHLRNKSRAEIHNQPQWETHLCKPVPQESETQWIQNGTRLEPPAPQISALALHHFTDLSNNNDF | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title